Practical programming tutorials for developers. Java, Spring Boot, JavaScript, React, Python, and DevOps guides with real-world examples.https://techyowls.io/en-ushttps://techyowls.io/blog/api-design-caching-strategies/https://techyowls.io/blog/api-design-caching-strategies/Master multi-layer caching architecture, HTTP cache headers, ETags, and cache invalidation patterns. Build fast, scalable APIs with proper caching.Sat, 27 Dec 2025 00:00:00 GMTSystem Designapicachingperformancerediscdnaihttps://techyowls.io/blog/api-design-graphql-grpc/https://techyowls.io/blog/api-design-graphql-grpc/Master modern API protocols beyond REST. Learn when to use GraphQL for flexible queries, gRPC for high-performance microservices, and how to implement both in production.Sat, 27 Dec 2025 00:00:00 GMTSystem Designapigraphqlgrpcmicroservicesprotobufaihttps://techyowls.io/blog/api-design-http-rest-fundamentals/https://techyowls.io/blog/api-design-http-rest-fundamentals/Master HTTP methods, status codes, and REST maturity model. The foundation every API developer needs - from GET/POST basics to idempotency and proper status code selection.Sat, 27 Dec 2025 00:00:00 GMTSystem Designapisystem-designresthttpinterviewsaihttps://techyowls.io/blog/api-design-resilience-observability/https://techyowls.io/blog/api-design-resilience-observability/Master circuit breakers, retry patterns, and the three pillars of observability. Build fault-tolerant APIs with proper metrics, logging, and distributed tracing.Sat, 27 Dec 2025 00:00:00 GMTSystem Designapiresiliencecircuit-breakerobservabilitymonitoringaihttps://techyowls.io/blog/api-design-versioning-idempotency/https://techyowls.io/blog/api-design-versioning-idempotency/Master API versioning strategies and idempotency patterns. Learn URL vs header versioning, version lifecycle management, and Stripe-style idempotency keys for reliable APIs.Sat, 27 Dec 2025 00:00:00 GMTSystem Designapiversioningidempotencyreliabilitysystem-designaihttps://techyowls.io/blog/api-design-security-authentication/https://techyowls.io/blog/api-design-security-authentication/Master API security layers, JWT implementation, OAuth 2.0 flows with PKCE. Production-grade patterns for authentication and authorization in modern APIs.Sat, 27 Dec 2025 00:00:00 GMTSystem Designapisecurityjwtoauthauthenticationaihttps://techyowls.io/blog/api-design-rate-limiting-pagination/https://techyowls.io/blog/api-design-rate-limiting-pagination/Master rate limiting algorithms, production Redis implementations, and cursor pagination. Protect your API from abuse while efficiently serving large datasets.Sat, 27 Dec 2025 00:00:00 GMTSystem Designapirate-limitingpaginationredisperformanceaihttps://techyowls.io/blog/api-design-production-mastery/https://techyowls.io/blog/api-design-production-mastery/Master real interview questions, production debugging, multi-tenancy, streaming, cost-aware design, and API governance. Complete your journey to senior API engineer.Sat, 27 Dec 2025 00:00:00 GMTSystem Designapiinterviewsdebuggingmulti-tenancygovernanceaihttps://techyowls.io/blog/api-system-design-complete-guide/https://techyowls.io/blog/api-system-design-complete-guide/Master API design from HTTP fundamentals to production systems. 8-part comprehensive guide covering REST, security, caching, GraphQL, gRPC, resilience, and interview preparation.Sat, 27 Dec 2025 00:00:00 GMTSystem Designapisystem-designrestinterviewsmicroservicesaihttps://techyowls.io/blog/cap-theorem-distributed-systems/https://techyowls.io/blog/cap-theorem-distributed-systems/Master the CAP theorem for system design interviews. Understand Consistency, Availability, Partition Tolerance trade-offs with real database examples like MongoDB, Cassandra, DynamoDB.Sat, 27 Dec 2025 00:00:00 GMTSystem Designsystem-designdistributed-systemsdatabasescap-theoremarchitectureaihttps://techyowls.io/blog/turborepo-advanced-patterns-production/https://techyowls.io/blog/turborepo-advanced-patterns-production/Master production Turborepo patterns with real-world examples. Migration guide, CI/CD pipelines, remote caching, testing strategies, and framework-specific configs.Fri, 19 Dec 2025 00:00:00 GMTJavaScriptturborepomonorepodevopstypescriptnextjscicdaihttps://techyowls.io/blog/build-dynamic-og-image-generator-nextjs/https://techyowls.io/blog/build-dynamic-og-image-generator-nextjs/Stop manually creating social preview images. Learn how to automatically generate unique Open Graph images for every blog post using Next.js and a screenshot API.Wed, 10 Dec 2025 00:00:00 GMTJavaScriptnextjsog-imagesocial-mediaapiautomationaihttps://techyowls.io/blog/side-project-ideas-that-make-money-2025/https://techyowls.io/blog/side-project-ideas-that-make-money-2025/Proven side project ideas for developers with real revenue examples. From micro-SaaS to digital products, find your next income stream.Wed, 10 Dec 2025 00:00:00 GMTJavaScriptaiside-projectindie-hackersaaspassive-incomeentrepreneurship2025https://techyowls.io/blog/surviving-tech-layoffs-developer-guide/https://techyowls.io/blog/surviving-tech-layoffs-developer-guide/Practical strategies for developers facing layoffs. From immediate action steps to long-term career resilience, this guide covers everything you need.Wed, 10 Dec 2025 00:00:00 GMTDevOpsaicareerlayoffsjob-searchfreelanceremote-work2025https://techyowls.io/blog/web-developer-roadmap-2025/https://techyowls.io/blog/web-developer-roadmap-2025/The ultimate web developer roadmap for 2025. Learn exactly what skills to master, tools to use, and steps to land your first developer job.Wed, 10 Dec 2025 00:00:00 GMTJavaScriptaicareerweb-developmentroadmapbeginnerfrontendbackend2025https://techyowls.io/blog/github-actions-cicd-java-spring-boot/https://techyowls.io/blog/github-actions-cicd-java-spring-boot/Build a complete CI/CD pipeline for Spring Boot: automated tests, Docker builds, staging deployments, and production releases with approval gates.Sun, 07 Dec 2025 00:00:00 GMTDevOpsgithub-actionsci-cdspring-bootdockerdevopshttps://techyowls.io/blog/flyway-database-migrations-spring-boot/https://techyowls.io/blog/flyway-database-migrations-spring-boot/Version control your database schema. Learn Flyway migration strategies, rollback approaches, and how to handle team collaboration without conflicts.Sun, 07 Dec 2025 00:00:00 GMTSpring Bootflywaydatabasemigrationsspring-bootpostgresqlhttps://techyowls.io/blog/gradle-multi-module-project-guide/https://techyowls.io/blog/gradle-multi-module-project-guide/Stop copying code between projects. Learn how to structure Gradle multi-module projects that enforce boundaries, speed up builds, and make your codebase maintainable.Sun, 07 Dec 2025 00:00:00 GMTJavagradlejavaarchitecturemulti-modulemonorepohttps://techyowls.io/blog/java-logging-best-practices-slf4j-logback/https://techyowls.io/blog/java-logging-best-practices-slf4j-logback/Structured logging, MDC for request tracing, log levels that make sense, and how to find that one request in millions of log lines.Sun, 07 Dec 2025 00:00:00 GMTDevOpsloggingslf4jlogbackobservabilityspring-boothttps://techyowls.io/blog/openapi-swagger-spring-boot-guide/https://techyowls.io/blog/openapi-swagger-spring-boot-guide/Generate beautiful, interactive API docs that can't go stale. Learn contract-first vs code-first, customization, and generating client SDKs.Sun, 07 Dec 2025 00:00:00 GMTSpring Bootopenapiswaggerspring-bootapi-documentationrest-apihttps://techyowls.io/blog/redis-caching-patterns-spring-boot/https://techyowls.io/blog/redis-caching-patterns-spring-boot/Beyond @Cacheable - learn cache-aside, write-through, read-through patterns, cache invalidation strategies, and how to avoid the thundering herd problem.Sun, 07 Dec 2025 00:00:00 GMTSpring Bootrediscachingspring-bootperformancedistributed-systemshttps://techyowls.io/blog/spring-boot-profiles-configuration-guide/https://techyowls.io/blog/spring-boot-profiles-configuration-guide/Master Spring profiles, externalized configuration, secrets management, and the 12-factor app approach to configuration.Sun, 07 Dec 2025 00:00:00 GMTSpring Bootspring-bootconfigurationprofilesenvironmentdevopshttps://techyowls.io/blog/spring-data-jpa-auditing-complete-guide/https://techyowls.io/blog/spring-data-jpa-auditing-complete-guide/Automatically track who changed what and when. Learn JPA auditing from basics to custom audit logs with revision history.Sun, 07 Dec 2025 00:00:00 GMTSpring Bootspring-data-jpaauditinghibernateenversjavahttps://techyowls.io/blog/spring-webflux-reactive-programming-guide/https://techyowls.io/blog/spring-webflux-reactive-programming-guide/Reactive programming isn't always the answer. Learn when WebFlux actually helps, how it works under the hood, and how to avoid the common pitfalls.Sun, 07 Dec 2025 00:00:00 GMTSpring Bootspring-webfluxreactivejavaperformanceproject-reactorhttps://techyowls.io/blog/testcontainers-spring-boot-integration-testing/https://techyowls.io/blog/testcontainers-spring-boot-integration-testing/Stop using H2 for tests. Learn how Testcontainers eliminates the 'works on my machine' problem by running real databases in Docker during tests.Sun, 07 Dec 2025 00:00:00 GMTSpring Boottestcontainersspring-bootdockerintegration-testingpostgresqlhttps://techyowls.io/blog/cursor-vs-claude-code-ai-coding-tools-2025/https://techyowls.io/blog/cursor-vs-claude-code-ai-coding-tools-2025/In-depth comparison of Cursor and Claude Code for AI-assisted development. Features, pricing, workflows, and which one wins for different use cases.Sat, 06 Dec 2025 00:00:00 GMTDevOpsaideveloper-toolsproductivitycursorclaudecodingautomationhttps://techyowls.io/blog/gleam-programming-language-tutorial-2025/https://techyowls.io/blog/gleam-programming-language-tutorial-2025/Learn Gleam, the type-safe functional language running on Erlang's BEAM. Installation, syntax, pattern matching, and building your first project with examples.Sat, 06 Dec 2025 00:00:00 GMTDevOpsaigleamfunctional-programmingerlangbeamelixirtypescriptbackendhttps://techyowls.io/blog/spring-boot-virtual-threads-java21/https://techyowls.io/blog/spring-boot-virtual-threads-java21/Master virtual threads in Spring Boot 3. Learn configuration, performance benchmarks, when to use them, common pitfalls, and production-ready patterns for high-throughput applications.Fri, 13 Dec 2024 00:00:00 GMTSpring Bootspring-bootjavavirtual-threadsjava-21concurrencyperformanceaihttps://techyowls.io/blog/kubernetes-helm-charts/https://techyowls.io/blog/kubernetes-helm-charts/Master Helm for Kubernetes deployments. Learn chart creation, templates, values, dependencies, and best practices for production applications.Thu, 12 Dec 2024 00:00:00 GMTDevOpskuberneteshelmdevopsk8sdeploymentaihttps://techyowls.io/blog/aws-lambda-serverless-guide/https://techyowls.io/blog/aws-lambda-serverless-guide/Master AWS Lambda for serverless computing. Learn function deployment, API Gateway integration, event triggers, and best practices for production.Wed, 11 Dec 2024 00:00:00 GMTDevOpsawslambdaserverlesscloudapi-gatewayaihttps://techyowls.io/blog/fine-tuning-llm-guide/https://techyowls.io/blog/fine-tuning-llm-guide/Learn to fine-tune large language models for your use case. Master LoRA, QLoRA, dataset preparation, and deploy custom models with OpenAI and Hugging Face.Tue, 10 Dec 2024 00:00:00 GMTPythonfine-tuningllmaimachine-learningopenaihuggingfacehttps://techyowls.io/blog/shadcn-ui-components-guide/https://techyowls.io/blog/shadcn-ui-components-guide/Master shadcn/ui for React applications. Learn component installation, customization, theming, and build accessible, beautiful user interfaces.Tue, 10 Dec 2024 00:00:00 GMTJavaScriptshadcn-uireactcomponentstailwinduiaihttps://techyowls.io/blog/rag-llm-applications/https://techyowls.io/blog/rag-llm-applications/Master Retrieval-Augmented Generation for LLM applications. Learn document processing, embeddings, vector search, and build production RAG systems.Mon, 09 Dec 2024 00:00:00 GMTPythonragllmailangchainvector-databasemachine-learninghttps://techyowls.io/blog/turborepo-monorepo-guide/https://techyowls.io/blog/turborepo-monorepo-guide/Master Turborepo for monorepo management. Learn workspace setup, caching, pipelines, and build performant multi-package JavaScript projects.Mon, 09 Dec 2024 00:00:00 GMTJavaScriptturborepomonorepobuildjavascriptdevopsaihttps://techyowls.io/blog/ai-coding-assistants-2025-comparison/https://techyowls.io/blog/ai-coding-assistants-2025-comparison/Compare the top AI coding assistants of 2025. Learn which tool fits your workflow - GitHub Copilot, Cursor, or Claude Code - with real benchmarks and use cases.Sun, 08 Dec 2024 00:00:00 GMTJavaScriptaicodingcopilotcursordeveloper-toolsproductivityhttps://techyowls.io/blog/react-hooks-complete-guide/https://techyowls.io/blog/react-hooks-complete-guide/Master all React hooks from basics to advanced. Learn useState, useEffect, useContext, useReducer, useMemo, useCallback, and create custom hooks.Sun, 08 Dec 2024 00:00:00 GMTJavaScriptreacthooksjavascriptfrontendweb-developmentaihttps://techyowls.io/blog/trpc-type-safe-api-guide/https://techyowls.io/blog/trpc-type-safe-api-guide/Master tRPC for full-stack TypeScript applications. Learn procedures, routers, React Query integration, and build type-safe APIs without schemas.Sun, 08 Dec 2024 00:00:00 GMTJavaScripttrpctypescriptapifullstackreactaihttps://techyowls.io/blog/ai-coding-assistants-2025-masterclass/https://techyowls.io/blog/ai-coding-assistants-2025-masterclass/Learn Cursor AI and GitHub Copilot with practical workflows and proven techniques to code 55% faster. Complete 2025 productivity guide.Fri, 06 Dec 2024 00:00:00 GMTDevOpsaicursor-aigithub-copilotproductivitytutorialcoding-assistantdeveloper-toolshttps://techyowls.io/blog/claude-computer-use-tutorial/https://techyowls.io/blog/claude-computer-use-tutorial/Master Claude's Computer Use API to build AI agents that see screens, click elements, and automate tasks. Complete Python tutorial with working code examples.Fri, 06 Dec 2024 00:00:00 GMTPythonclaudeanthropicai-agentscomputer-useautomationaipythonhttps://techyowls.io/blog/argocd-gitops-guide/https://techyowls.io/blog/argocd-gitops-guide/Master ArgoCD for Kubernetes deployments. Learn GitOps principles, application management, sync strategies, and automate your deployment pipeline.Thu, 05 Dec 2024 00:00:00 GMTDevOpsargocdgitopskubernetescicddevopsaihttps://techyowls.io/blog/fastapi-htmx-tutorial-python-fullstack/https://techyowls.io/blog/fastapi-htmx-tutorial-python-fullstack/Tired of 'npm install' and complex state management? Learn how to build modern, dynamic user interfaces using only Python, HTML, and HTMX.Thu, 05 Dec 2024 00:00:00 GMTPythonpythonfastapihtmxweb-developmentfull-stackhttps://techyowls.io/blog/graphql-api-tutorial/https://techyowls.io/blog/graphql-api-tutorial/Master GraphQL API development from scratch. Learn schema design, resolvers, queries, mutations, subscriptions, and authentication best practices.Thu, 05 Dec 2024 00:00:00 GMTJavaScriptgraphqlapinodejsjavascriptbackendaihttps://techyowls.io/blog/nextjs-14-tutorial/https://techyowls.io/blog/nextjs-14-tutorial/Master Next.js 14 with App Router. Learn server components, data fetching, routing, server actions, and build full-stack React applications.Thu, 05 Dec 2024 00:00:00 GMTJavaScriptnextjsreactjavascripttypescriptweb-developmentaihttps://techyowls.io/blog/bun-runtime-guide/https://techyowls.io/blog/bun-runtime-guide/Master Bun for JavaScript development. Learn the runtime, package manager, bundler, test runner, and build faster applications with Bun.Wed, 04 Dec 2024 00:00:00 GMTJavaScriptbunjavascripttypescriptruntimenodejsaihttps://techyowls.io/blog/fastapi-python-tutorial/https://techyowls.io/blog/fastapi-python-tutorial/Master FastAPI for building high-performance Python APIs. Learn async endpoints, validation, authentication, database integration, and deployment.Wed, 04 Dec 2024 00:00:00 GMTPythonpythonfastapiapirest-apibackendaihttps://techyowls.io/blog/mongodb-nodejs-tutorial/https://techyowls.io/blog/mongodb-nodejs-tutorial/Master MongoDB with Node.js and Mongoose. Learn CRUD operations, schema design, indexing, aggregation pipelines, and production best practices.Wed, 04 Dec 2024 00:00:00 GMTJavaScriptmongodbnodejsdatabasemongoosebackendaihttps://techyowls.io/blog/python-infrastructure-as-code-pulumi/https://techyowls.io/blog/python-infrastructure-as-code-pulumi/Infrastructure as Code shouldn't be a copy-paste nightmare. Learn how to use Pulumi and Python to programmatically deploy scalable AI infrastructure without the YAML fatigue.Wed, 04 Dec 2024 00:00:00 GMTDevOpspythondevopsiacpulumiaiawshttps://techyowls.io/blog/spring-ai-mcp-complete-guide/https://techyowls.io/blog/spring-ai-mcp-complete-guide/Connect your Spring Boot app to external tools, databases, and APIs using Model Context Protocol. Complete guide with working code.Wed, 04 Dec 2024 00:00:00 GMTSpring Bootspring-aimcpai-agentsjavallmaihttps://techyowls.io/blog/fastapi-tutorial-full-project/https://techyowls.io/blog/fastapi-tutorial-full-project/Build a complete production-ready FastAPI application. Combine all concepts into a real-world e-commerce API with authentication, database, and deployment.Tue, 03 Dec 2024 00:00:00 GMTPythonfastapipythonapiproductionprojecttutorialaihttps://techyowls.io/blog/fastapi-tutorial-openapi-documentation/https://techyowls.io/blog/fastapi-tutorial-openapi-documentation/Create professional API documentation with FastAPI. Learn OpenAPI customization, Swagger UI, ReDoc, and documentation best practices.Tue, 03 Dec 2024 00:00:00 GMTPythonfastapipythonopenapiswaggerdocumentationtutorialaihttps://techyowls.io/blog/production-ai-agents-deployment-guide/https://techyowls.io/blog/production-ai-agents-deployment-guide/Deploy AI agents to production with confidence. Learn monitoring with LangSmith, evaluation strategies, security best practices, and scalable deployment patterns.Tue, 03 Dec 2024 00:00:00 GMTPythonai-agentsproductionlangsmithdeploymentmonitoringdevopsaillmhttps://techyowls.io/blog/spring-ai-structured-output-json/https://techyowls.io/blog/spring-ai-structured-output-json/Convert unpredictable LLM text into type-safe Java objects. BeanOutputConverter, ListOutputConverter, and custom converters explained.Tue, 03 Dec 2024 00:00:00 GMTSpring Bootspring-aillmjsonstructured-outputjavaaihttps://techyowls.io/blog/spring-security-production-best-practices/https://techyowls.io/blog/spring-security-production-best-practices/Deploy secure Spring Boot applications with production-grade security configurations, monitoring, rate limiting, and comprehensive security hardening techniques.Tue, 03 Dec 2024 00:00:00 GMTSpring BootSpring SecurityProduction SecuritySecurity HardeningRate LimitingSecurity MonitoringDevSecOpsaihttps://techyowls.io/blog/build-mcp-server-python-tutorial/https://techyowls.io/blog/build-mcp-server-python-tutorial/Learn to build a Model Context Protocol (MCP) server from scratch. Create a GitHub MCP server that lets Claude interact with repositories, issues, and pull requests.Mon, 02 Dec 2024 00:00:00 GMTPythonaimcpclaudepythonapianthropicautomationhttps://techyowls.io/blog/fastapi-tutorial-docker-deployment/https://techyowls.io/blog/fastapi-tutorial-docker-deployment/Deploy FastAPI applications to production. Learn Docker containerization, Docker Compose, cloud deployment, and production best practices.Mon, 02 Dec 2024 00:00:00 GMTPythonfastapipythondockerdeploymentdevopstutorialaihttps://techyowls.io/blog/langchain4j-java-complete-guide/https://techyowls.io/blog/langchain4j-java-complete-guide/Complete guide to LangChain4j - RAG, memory, agents, and tools for Java developers. Stop rewriting Python code.Mon, 02 Dec 2024 00:00:00 GMTSpring Bootlangchain4jjavaairagllmopenaihttps://techyowls.io/blog/model-context-protocol-mcp-guide/https://techyowls.io/blog/model-context-protocol-mcp-guide/Master MCP to connect Claude and other LLMs to external tools, databases, and APIs. Complete guide with Python and TypeScript examples for building MCP servers.Mon, 02 Dec 2024 00:00:00 GMTPythonmcpclaudeaillmpythontypescriptai-toolsanthropichttps://techyowls.io/blog/ollama-local-llm-ai-agents/https://techyowls.io/blog/ollama-local-llm-ai-agents/Run AI agents 100% locally with Ollama. Learn to set up Llama 3.2, Mistral, and DeepSeek, then build production-ready agents that work offline with full privacy.Mon, 02 Dec 2024 00:00:00 GMTPythonollamalocal-llmai-agentsaillmpythonprivacyllamahttps://techyowls.io/blog/deno-2-javascript-runtime/https://techyowls.io/blog/deno-2-javascript-runtime/Master Deno 2.0 for modern JavaScript and TypeScript development. Learn built-in tooling, npm compatibility, security model, and migration from Node.js.Sun, 01 Dec 2024 00:00:00 GMTJavaScriptaidenojavascripttypescriptruntimenodejshttps://techyowls.io/blog/fastapi-tutorial-security-best-practices/https://techyowls.io/blog/fastapi-tutorial-security-best-practices/Secure your FastAPI application against common vulnerabilities. Learn input validation, rate limiting, CORS, and OWASP security patterns.Sun, 01 Dec 2024 00:00:00 GMTPythonfastapipythonsecurityowaspapitutorialaihttps://techyowls.io/blog/getting-started-with-machine-learning-python/https://techyowls.io/blog/getting-started-with-machine-learning-python/Learn machine learning fundamentals with Python. Build your first ML models using scikit-learn with hands-on examples for classification, regression, and real-world predictions.Sun, 01 Dec 2024 00:00:00 GMTPythonpythonmachine-learningaiscikit-learndata-sciencehttps://techyowls.io/blog/langchain-python-tutorial/https://techyowls.io/blog/langchain-python-tutorial/Master LangChain for building LLM-powered applications. Learn chains, agents, memory, RAG, and integrate with OpenAI, HuggingFace, and vector databases.Sun, 01 Dec 2024 00:00:00 GMTPythonpythonlangchainllmaiopenaimachine-learninghttps://techyowls.io/blog/multi-agent-systems-crewai-langgraph/https://techyowls.io/blog/multi-agent-systems-crewai-langgraph/Master multi-agent orchestration with CrewAI and LangGraph. Build specialized AI teams that collaborate, delegate tasks, and solve complex problems together.Sun, 01 Dec 2024 00:00:00 GMTPythonmulti-agentcrewailanggraphai-agentsaillmpythonautomationhttps://techyowls.io/blog/sqlalchemy-python-orm-guide/https://techyowls.io/blog/sqlalchemy-python-orm-guide/Master SQLAlchemy 2.0 for Python database operations. Learn ORM, async support, relationships, migrations, and build robust data layers.Sun, 01 Dec 2024 00:00:00 GMTPythonsqlalchemyormpythondatabasepostgresqlaihttps://techyowls.io/blog/tanstack-query-react-guide/https://techyowls.io/blog/tanstack-query-react-guide/Master TanStack Query (React Query) for data fetching. Learn queries, mutations, caching, pagination, optimistic updates, and real-world patterns.Sun, 01 Dec 2024 00:00:00 GMTJavaScripttanstack-queryreact-queryreactdata-fetchingfrontendaihttps://techyowls.io/blog/deep-learning-pytorch-tutorial/https://techyowls.io/blog/deep-learning-pytorch-tutorial/Learn deep learning with PyTorch from scratch. Build neural networks, CNNs, RNNs, and train models for image classification and NLP tasks.Sat, 30 Nov 2024 00:00:00 GMTPythonpythonpytorchdeep-learningneural-networksaimachine-learninghttps://techyowls.io/blog/drizzle-orm-typescript-guide/https://techyowls.io/blog/drizzle-orm-typescript-guide/Master Drizzle ORM for TypeScript applications. Learn schema definition, queries, migrations, relations, and build type-safe database layers.Sat, 30 Nov 2024 00:00:00 GMTJavaScriptdrizzleormtypescriptdatabasepostgresqlaihttps://techyowls.io/blog/fastapi-tutorial-performance-caching/https://techyowls.io/blog/fastapi-tutorial-performance-caching/Optimize FastAPI performance with caching, async operations, connection pooling, and profiling. Build blazing-fast APIs.Sat, 30 Nov 2024 00:00:00 GMTPythonfastapipythonperformancecachingredistutorialaihttps://techyowls.io/blog/spring-boot-ai-complete-guide/https://techyowls.io/blog/spring-boot-ai-complete-guide/Master Spring AI with this comprehensive 2025 guide. Learn to build production-ready AI applications in Java with OpenAI, Ollama, RAG systems, vector stores, and complete code examples.Sat, 30 Nov 2024 00:00:00 GMTJavaaijavaspring-boottutorialspring-airagopenaihttps://techyowls.io/blog/vercel-ai-sdk-nextjs-guide/https://techyowls.io/blog/vercel-ai-sdk-nextjs-guide/Master the Vercel AI SDK to build streaming AI chatbots, generative UIs, and AI-powered features in Next.js. Complete guide with OpenAI, Anthropic, and tool use examples.Sat, 30 Nov 2024 00:00:00 GMTJavaScriptvercelai-sdknextjsreactaiopenaianthropicstreamingchatbothttps://techyowls.io/blog/websockets-realtime-applications/https://techyowls.io/blog/websockets-realtime-applications/Master WebSocket development for real-time apps. Learn Socket.IO, authentication, scaling, error handling, and build chat and notification systems.Sat, 30 Nov 2024 00:00:00 GMTJavaScriptwebsocketssocket-ionodejsreal-timebackendaihttps://techyowls.io/blog/fastapi-tutorial-testing/https://techyowls.io/blog/fastapi-tutorial-testing/Write comprehensive tests for FastAPI applications. Learn pytest, TestClient, database testing, mocking, and test-driven development patterns.Fri, 29 Nov 2024 00:00:00 GMTPythonfastapipythontestingpytesttddtutorialaihttps://techyowls.io/blog/langgraph-ai-agents-state-machines/https://techyowls.io/blog/langgraph-ai-agents-state-machines/Master LangGraph for building production AI agents. Learn state graphs, conditional routing, cycles, and persistence patterns with hands-on examples.Fri, 29 Nov 2024 00:00:00 GMTPythonlanggraphai-agentsaillmpythonlangchainstate-machineshttps://techyowls.io/blog/python-asyncio-tutorial/https://techyowls.io/blog/python-asyncio-tutorial/Learn Python async/await for concurrent programming. Master coroutines, tasks, event loops, and build high-performance async applications.Fri, 29 Nov 2024 00:00:00 GMTPythonpythonasyncioasyncconcurrencyperformanceaihttps://techyowls.io/blog/rest-api-design-best-practices/https://techyowls.io/blog/rest-api-design-best-practices/Master REST API design with industry best practices. Learn naming conventions, versioning, error handling, pagination, and security patterns.Fri, 29 Nov 2024 00:00:00 GMTSpring Bootrest-apiapi-designspring-bootjavabackendaihttps://techyowls.io/blog/supabase-backend-guide/https://techyowls.io/blog/supabase-backend-guide/Master Supabase for full-stack development. Learn PostgreSQL database, authentication, real-time subscriptions, storage, and build modern applications.Fri, 29 Nov 2024 00:00:00 GMTJavaScriptsupabasepostgresqlbackenddatabaseauthenticationaihttps://techyowls.io/blog/visitor-design-pattern/https://techyowls.io/blog/visitor-design-pattern/Master the Visitor Pattern in Java. Learn how to add new operations to object structures using double dispatch.Fri, 29 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsvisitordouble-dispatchoophttps://techyowls.io/blog/api-rate-limiting-guide/https://techyowls.io/blog/api-rate-limiting-guide/Master API rate limiting for production systems. Learn token bucket, sliding window, Redis-based limiting, and protect your APIs from abuse.Thu, 28 Nov 2024 00:00:00 GMTPythonrate-limitingapisecurityredisfastapiaihttps://techyowls.io/blog/celery-task-queue-guide/https://techyowls.io/blog/celery-task-queue-guide/Master Celery for Python background task processing. Learn task queues, scheduling, monitoring, error handling, and build scalable async workflows.Thu, 28 Nov 2024 00:00:00 GMTPythoncelerytask-queuepythonredisbackground-jobsaihttps://techyowls.io/blog/docker-best-practices-production/https://techyowls.io/blog/docker-best-practices-production/Master Docker best practices for production deployments. Learn image optimization, security hardening, multi-stage builds, and container orchestration.Thu, 28 Nov 2024 00:00:00 GMTDevOpsdockercontainersdevopssecuritybest-practicesaihttps://techyowls.io/blog/fastapi-tutorial-file-uploads/https://techyowls.io/blog/fastapi-tutorial-file-uploads/Handle file uploads in FastAPI. Learn form data, file validation, cloud storage integration with S3, and serving static files.Thu, 28 Nov 2024 00:00:00 GMTPythonfastapipythonfile-uploads3storagetutorialaihttps://techyowls.io/blog/java-21-virtual-threads-complete-guide/https://techyowls.io/blog/java-21-virtual-threads-complete-guide/Master Java 21 virtual threads to scale from 5,000 to 5,000,000 concurrent operations. Practical examples, benchmarks, and migration guide.Thu, 28 Nov 2024 00:00:00 GMTSpring Bootjava-21virtual-threadsconcurrencyperformanceaihttps://techyowls.io/blog/kubernetes-beginners-complete-guide/https://techyowls.io/blog/kubernetes-beginners-complete-guide/Learn Kubernetes from scratch. Understand pods, deployments, services, and how to deploy your first application to a Kubernetes cluster with practical examples.Thu, 28 Nov 2024 00:00:00 GMTDevOpskubernetesdockerdevopscontainersk8saihttps://techyowls.io/blog/apache-kafka-event-streaming/https://techyowls.io/blog/apache-kafka-event-streaming/Master Apache Kafka for event-driven architectures. Learn producers, consumers, topics, partitions, Kafka Streams, and build scalable data pipelines.Wed, 27 Nov 2024 00:00:00 GMTSystem Designkafkaevent-streamingmessagingmicroservicesbackendaihttps://techyowls.io/blog/ai-agents-tools-web-search-code-execution/https://techyowls.io/blog/ai-agents-tools-web-search-code-execution/Build powerful AI agents with real-world tools. Learn to integrate web search, execute code safely, work with files, and connect to external APIs using LangGraph.Wed, 27 Nov 2024 00:00:00 GMTPythonai-agentsaillmpythonlangchaintoolsweb-searchautomationhttps://techyowls.io/blog/docker-compose-multi-container-apps/https://techyowls.io/blog/docker-compose-multi-container-apps/Master Docker Compose for multi-container applications. Learn to define, configure, and run complex application stacks with practical examples including web apps with databases.Wed, 27 Nov 2024 00:00:00 GMTDevOpsdockerdocker-composedevopscontainersmicroservicesaihttps://techyowls.io/blog/fastapi-tutorial-middleware-events/https://techyowls.io/blog/fastapi-tutorial-middleware-events/Master FastAPI middleware for request processing. Learn custom middleware, CORS, request logging, and application lifecycle events.Wed, 27 Nov 2024 00:00:00 GMTPythonfastapipythonmiddlewareeventstutorialaihttps://techyowls.io/blog/microservices-patterns-guide/https://techyowls.io/blog/microservices-patterns-guide/Master microservices architecture patterns. Learn service discovery, circuit breakers, saga pattern, API gateway, and build resilient distributed systems.Wed, 27 Nov 2024 00:00:00 GMTSystem Designmicroservicesarchitecturedesign-patternsdistributed-systemspythonaihttps://techyowls.io/blog/prometheus-grafana-monitoring/https://techyowls.io/blog/prometheus-grafana-monitoring/Set up production monitoring with Prometheus and Grafana. Learn metrics collection, alerting, dashboards, and best practices for observability.Wed, 27 Nov 2024 00:00:00 GMTDevOpsprometheusgrafanamonitoringdevopsobservabilityaihttps://techyowls.io/blog/template-method-design-pattern/https://techyowls.io/blog/template-method-design-pattern/Master the Template Method Pattern in Java. Learn how to define the skeleton of an algorithm in a superclass but let subclasses override specific steps.Wed, 27 Nov 2024 00:00:00 GMTJavaaijavadesign-patternstemplate-methodinheritancerefactoringhttps://techyowls.io/blog/aws-ec2-deployment-guide/https://techyowls.io/blog/aws-ec2-deployment-guide/Deploy applications on AWS EC2 from scratch. Learn instance setup, security groups, load balancing, auto-scaling, and production best practices.Tue, 26 Nov 2024 00:00:00 GMTDevOpsawsec2devopsclouddeploymentaihttps://techyowls.io/blog/fastapi-tutorial-websockets/https://techyowls.io/blog/fastapi-tutorial-websockets/Build real-time features with FastAPI WebSockets. Learn bidirectional communication, chat systems, live updates, and broadcasting patterns.Tue, 26 Nov 2024 00:00:00 GMTPythonfastapipythonwebsocketsreal-timetutorialaihttps://techyowls.io/blog/github-actions-cicd-pipeline/https://techyowls.io/blog/github-actions-cicd-pipeline/Build automated CI/CD pipelines with GitHub Actions. Learn workflows, jobs, actions, and deploy applications automatically with practical examples.Tue, 26 Nov 2024 00:00:00 GMTDevOpsgithub-actionscicddevopsautomationdockeraihttps://techyowls.io/blog/grpc-python-microservices/https://techyowls.io/blog/grpc-python-microservices/Master gRPC for Python microservices. Learn Protocol Buffers, streaming, authentication, and build efficient inter-service communication.Tue, 26 Nov 2024 00:00:00 GMTPythongrpcmicroservicespythonprotocol-buffersapiaihttps://techyowls.io/blog/java-streams-api-complete-guide/https://techyowls.io/blog/java-streams-api-complete-guide/Master Java Streams for clean, efficient data processing. Map, filter, reduce, collectors, parallel streams, and real-world patterns.Tue, 26 Nov 2024 00:00:00 GMTSpring Bootjavastreamsfunctional-programmingcollectionsaihttps://techyowls.io/blog/openai-api-python-tutorial/https://techyowls.io/blog/openai-api-python-tutorial/Master the OpenAI API for building AI applications. Learn GPT-4, embeddings, function calling, assistants API, and production best practices.Tue, 26 Nov 2024 00:00:00 GMTPythonopenaigptapipythonaimachine-learninghttps://techyowls.io/blog/spring-security-oauth2-social-login/https://techyowls.io/blog/spring-security-oauth2-social-login/Implement OAuth2 social login in Spring Boot. Learn Google, GitHub authentication, custom OAuth2 providers, and combining with JWT.Tue, 26 Nov 2024 00:00:00 GMTSpring Bootspring-securityoauth2spring-bootjavagoogle-logingithub-loginaihttps://techyowls.io/blog/vector-databases-ai-applications/https://techyowls.io/blog/vector-databases-ai-applications/Learn vector databases for AI and ML applications. Compare Pinecone, Chroma, Weaviate, and build semantic search with embeddings.Tue, 26 Nov 2024 00:00:00 GMTPythonvector-databaseembeddingsaimachine-learningpineconechromadbhttps://techyowls.io/blog/ai-agents-fundamentals-build-from-scratch/https://techyowls.io/blog/ai-agents-fundamentals-build-from-scratch/Master AI agents from the ground up. Learn the agent loop, build a working agent in pure Python, and understand the foundations that power LangGraph and CrewAI.Mon, 25 Nov 2024 00:00:00 GMTPythonai-agentsaillmpythonlangchainautomationmachine-learninghttps://techyowls.io/blog/elasticsearch-search-guide/https://techyowls.io/blog/elasticsearch-search-guide/Master Elasticsearch for full-text search. Learn indexing, queries, aggregations, and build powerful search applications with Python.Mon, 25 Nov 2024 00:00:00 GMTSystem Designelasticsearchsearchdatabasepythonfull-textaihttps://techyowls.io/blog/fastapi-tutorial-background-tasks/https://techyowls.io/blog/fastapi-tutorial-background-tasks/Handle long-running operations in FastAPI. Learn built-in BackgroundTasks, Celery integration, task queues, and async processing patterns.Mon, 25 Nov 2024 00:00:00 GMTPythonfastapipythoncelerybackground-tasksasynctutorialaihttps://techyowls.io/blog/jenkins-pipeline-cicd-tutorial/https://techyowls.io/blog/jenkins-pipeline-cicd-tutorial/Master Jenkins pipelines for CI/CD automation. Learn declarative and scripted pipelines, stages, parallel execution, and deployment strategies.Mon, 25 Nov 2024 00:00:00 GMTDevOpsjenkinsci-cddevopsautomationpipelineaihttps://techyowls.io/blog/strategy-design-pattern/https://techyowls.io/blog/strategy-design-pattern/Master the Strategy Pattern in Java. Learn how to replace complex if-else logic with interchangeable algorithms and follow the Open/Closed Principle.Mon, 25 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsstrategyclean-coderefactoringhttps://techyowls.io/blog/terraform-infrastructure-as-code/https://techyowls.io/blog/terraform-infrastructure-as-code/Learn Terraform from scratch. Build and manage cloud infrastructure with code using practical AWS examples, modules, and best practices.Mon, 25 Nov 2024 00:00:00 GMTDevOpsterraformdevopsawsinfrastructureiacaihttps://techyowls.io/blog/vite-react-setup-guide/https://techyowls.io/blog/vite-react-setup-guide/Master Vite for React development. Learn project setup, configuration, plugins, environment variables, and production optimization.Mon, 25 Nov 2024 00:00:00 GMTJavaScriptvitereactfrontendjavascriptbuild-toolsaihttps://techyowls.io/blog/authentication-jwt-oauth-guide/https://techyowls.io/blog/authentication-jwt-oauth-guide/Master authentication for web applications. Learn JWT tokens, OAuth 2.0 flows, refresh tokens, and implement secure authentication systems.Sun, 24 Nov 2024 00:00:00 GMTJavaScriptauthenticationjwtoauthsecuritynodejsaihttps://techyowls.io/blog/fastapi-tutorial-rbac-permissions/https://techyowls.io/blog/fastapi-tutorial-rbac-permissions/Implement RBAC in FastAPI. Learn user roles, permissions, scopes, and granular access control for secure multi-tenant applications.Sun, 24 Nov 2024 00:00:00 GMTPythonfastapipythonrbacpermissionssecuritytutorialaihttps://techyowls.io/blog/linux-commands-devops-engineers/https://techyowls.io/blog/linux-commands-devops-engineers/Master the most important Linux commands for DevOps. From file operations to process management, networking, and system administration with practical examples.Sun, 24 Nov 2024 00:00:00 GMTDevOpslinuxdevopsbashcommandssysadminaihttps://techyowls.io/blog/redis-caching-guide/https://techyowls.io/blog/redis-caching-guide/Master Redis caching for web applications. Learn cache strategies, data structures, pub/sub, sessions, and build scalable caching solutions.Sun, 24 Nov 2024 00:00:00 GMTSystem Designrediscachingdatabaseperformancepythonaihttps://techyowls.io/blog/redis-caching-spring-boot/https://techyowls.io/blog/redis-caching-spring-boot/Master Redis caching in Spring Boot applications. Learn cache configuration, annotations, TTL management, and performance optimization techniques.Sun, 24 Nov 2024 00:00:00 GMTSpring Bootspring-bootrediscachingjavaperformanceaihttps://techyowls.io/blog/spring-boot-testing-complete-guide/https://techyowls.io/blog/spring-boot-testing-complete-guide/Test Spring Boot apps properly. Unit tests, @WebMvcTest, @DataJpaTest, Testcontainers, and test slices explained with real examples.Sun, 24 Nov 2024 00:00:00 GMTSpring Bootspring-boottestingjunittestcontainersaihttps://techyowls.io/blog/spring-security-method-level-authorization/https://techyowls.io/blog/spring-security-method-level-authorization/Master method-level security in Spring Boot. Learn @PreAuthorize, @PostAuthorize, SpEL expressions, custom permissions, and domain object security.Sun, 24 Nov 2024 00:00:00 GMTSpring Bootspring-securityspring-bootjavaauthorizationpreauthorizeaihttps://techyowls.io/blog/zustand-react-state-management/https://techyowls.io/blog/zustand-react-state-management/Master Zustand for React state management. Learn store creation, async actions, middleware, persistence, and TypeScript integration patterns.Sun, 24 Nov 2024 00:00:00 GMTJavaScriptzustandreactstate-managementjavascriptfrontendaihttps://techyowls.io/blog/fastapi-tutorial-jwt-authentication/https://techyowls.io/blog/fastapi-tutorial-jwt-authentication/Implement JWT authentication in FastAPI. Learn token generation, password hashing, OAuth2 flows, refresh tokens, and protecting API endpoints.Sat, 23 Nov 2024 00:00:00 GMTPythonfastapipythonjwtauthenticationsecuritytutorialaihttps://techyowls.io/blog/pandas-data-analysis-tutorial/https://techyowls.io/blog/pandas-data-analysis-tutorial/Master Pandas for data analysis. Learn DataFrames, data cleaning, manipulation, grouping, merging, and visualization with practical examples.Sat, 23 Nov 2024 00:00:00 GMTPythonpythonpandasdata-sciencedata-analysisaimachine-learninghttps://techyowls.io/blog/prisma-orm-nodejs-guide/https://techyowls.io/blog/prisma-orm-nodejs-guide/Master Prisma for Node.js database operations. Learn schema design, migrations, queries, relations, and build type-safe database applications.Sat, 23 Nov 2024 00:00:00 GMTJavaScriptprismaormnodejsdatabasetypescriptaihttps://techyowls.io/blog/scikit-learn-machine-learning-tutorial/https://techyowls.io/blog/scikit-learn-machine-learning-tutorial/Complete guide to machine learning with scikit-learn. Learn classification, regression, clustering, model evaluation, and building ML pipelines.Sat, 23 Nov 2024 00:00:00 GMTPythonpythonscikit-learnmachine-learningdata-scienceaiclassificationhttps://techyowls.io/blog/state-design-pattern/https://techyowls.io/blog/state-design-pattern/Master the State Pattern in Java. Learn how to let an object alter its behavior when its internal state changes, replacing massive switch statements.Sat, 23 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsstatestate-machinerefactoringhttps://techyowls.io/blog/whisper-api-transcription-guide/https://techyowls.io/blog/whisper-api-transcription-guide/Master OpenAI's Whisper API for audio transcription. Learn speech-to-text, translation, timestamps, and build production transcription services.Sat, 23 Nov 2024 00:00:00 GMTPythonwhisperopenaispeech-to-texttranscriptionaiapihttps://techyowls.io/blog/claude-ai-api-guide/https://techyowls.io/blog/claude-ai-api-guide/Master Claude AI API for building AI applications. Learn chat completions, tool use, vision, streaming, and production best practices.Fri, 22 Nov 2024 00:00:00 GMTPythonclaudeanthropicapiaillmmachine-learninghttps://techyowls.io/blog/fastapi-tutorial-error-handling/https://techyowls.io/blog/fastapi-tutorial-error-handling/Master error handling in FastAPI. Learn custom exceptions, global handlers, validation errors, and building user-friendly error responses.Fri, 22 Nov 2024 00:00:00 GMTPythonfastapipythonerror-handlingexceptionsapitutorialaihttps://techyowls.io/blog/nlp-spacy-python-tutorial/https://techyowls.io/blog/nlp-spacy-python-tutorial/Master natural language processing with spaCy Python. Learn tokenization, NER, POS tagging, text classification, and build NLP pipelines for production.Fri, 22 Nov 2024 00:00:00 GMTPythonnlpspacypythontext-processingaimachine-learninghttps://techyowls.io/blog/spring-boot-jwt-authentication/https://techyowls.io/blog/spring-boot-jwt-authentication/Implement JWT authentication in Spring Boot 3. Learn Spring Security 6, token generation, validation, refresh tokens, and role-based access control.Fri, 22 Nov 2024 00:00:00 GMTSpring Bootspring-bootjwtspring-securityjavaauthenticationaihttps://techyowls.io/blog/spring-boot-testing-junit-mockito/https://techyowls.io/blog/spring-boot-testing-junit-mockito/Master Spring Boot testing with JUnit 5 and Mockito. Learn unit testing, integration testing, mocking dependencies, and test-driven development.Fri, 22 Nov 2024 00:00:00 GMTSpring Bootspring-bootjunitmockitotestingjavaaihttps://techyowls.io/blog/spring-security-csrf-cors-headers/https://techyowls.io/blog/spring-security-csrf-cors-headers/Master CSRF protection, CORS configuration, and security headers in Spring Boot. Learn when to disable CSRF, configure CORS properly, and add security headers.Fri, 22 Nov 2024 00:00:00 GMTSpring Bootspring-securitycsrfcorsspring-bootjavasecurity-headersaihttps://techyowls.io/blog/spring-security-jwt-complete-guide/https://techyowls.io/blog/spring-security-jwt-complete-guide/Implement JWT authentication in Spring Boot 3. Token generation, validation, refresh tokens, and security best practices.Fri, 22 Nov 2024 00:00:00 GMTSpring Bootspring-securityjwtauthenticationspring-bootaihttps://techyowls.io/blog/fastapi-tutorial-crud-operations/https://techyowls.io/blog/fastapi-tutorial-crud-operations/Build production-ready CRUD APIs with FastAPI. Learn RESTful patterns, pagination, filtering, bulk operations, and best practices for real-world applications.Thu, 21 Nov 2024 00:00:00 GMTPythonfastapipythoncrudrest-apitutorialaihttps://techyowls.io/blog/matplotlib-data-visualization-python/https://techyowls.io/blog/matplotlib-data-visualization-python/Master data visualization with Matplotlib. Learn to create line plots, bar charts, scatter plots, histograms, and customize your visualizations.Thu, 21 Nov 2024 00:00:00 GMTPythonpythonmatplotlibdata-visualizationdata-scienceaimachine-learninghttps://techyowls.io/blog/observer-design-pattern/https://techyowls.io/blog/observer-design-pattern/Master the Observer Pattern in Java. Learn how to implement event-driven architectures and decouple data sources from listeners.Thu, 21 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsobservereventsoophttps://techyowls.io/blog/openai-chatgpt-api-python/https://techyowls.io/blog/openai-chatgpt-api-python/Learn to use OpenAI's ChatGPT API in Python. Build chatbots, generate content, and integrate AI into your applications with practical examples.Thu, 21 Nov 2024 00:00:00 GMTPythonpythonopenaichatgptaimachine-learningapihttps://techyowls.io/blog/prompt-engineering-guide/https://techyowls.io/blog/prompt-engineering-guide/Learn prompt engineering techniques for ChatGPT, Claude, and other LLMs. Master zero-shot, few-shot, chain-of-thought, and advanced prompting strategies.Thu, 21 Nov 2024 00:00:00 GMTPythonprompt-engineeringaillmchatgptclaudemachine-learninghttps://techyowls.io/blog/speech-recognition-python-guide/https://techyowls.io/blog/speech-recognition-python-guide/Build speech recognition applications with Python. Learn speech-to-text, voice commands, audio processing with Whisper, SpeechRecognition, and real-time transcription.Thu, 21 Nov 2024 00:00:00 GMTPythonspeech-recognitionpythonwhispervoiceaimachine-learninghttps://techyowls.io/blog/fastapi-tutorial-database-sqlalchemy/https://techyowls.io/blog/fastapi-tutorial-database-sqlalchemy/Connect FastAPI to databases using SQLAlchemy. Learn ORM models, relationships, migrations with Alembic, and async database operations.Wed, 20 Nov 2024 00:00:00 GMTPythonfastapipythonsqlalchemydatabaseormtutorialaihttps://techyowls.io/blog/llama-local-llm-guide/https://techyowls.io/blog/llama-local-llm-guide/Deploy Llama and other open-source LLMs locally. Learn Ollama, llama.cpp, quantization, and build private AI applications without cloud APIs.Wed, 20 Nov 2024 00:00:00 GMTPythonllamaollamalocal-llmaimachine-learningprivacyhttps://techyowls.io/blog/rest-api-best-practices-java/https://techyowls.io/blog/rest-api-best-practices-java/Build REST APIs that are consistent, discoverable, and maintainable. Naming, versioning, error handling, pagination, and HATEOAS explained.Wed, 20 Nov 2024 00:00:00 GMTSpring Bootrest-apispring-bootjavaapi-designaihttps://techyowls.io/blog/spring-boot-microservices-tutorial/https://techyowls.io/blog/spring-boot-microservices-tutorial/Build production-ready microservices with Spring Boot and Spring Cloud. Learn service discovery, API gateway, config server, and inter-service communication.Wed, 20 Nov 2024 00:00:00 GMTSpring Bootspring-bootmicroservicesspring-cloudjavadockeraihttps://techyowls.io/blog/spring-security-database-authentication/https://techyowls.io/blog/spring-security-database-authentication/Implement database authentication in Spring Security. Learn UserDetailsService, password encoding, account locking, and multi-tenant authentication.Wed, 20 Nov 2024 00:00:00 GMTSpring Bootspring-securityspring-bootjavaauthenticationdatabaseaihttps://techyowls.io/blog/ai-agents-autonomous-systems/https://techyowls.io/blog/ai-agents-autonomous-systems/Master AI agent development with LangChain and AutoGen. Learn agent architectures, tool use, multi-agent systems, and build autonomous AI applications.Tue, 19 Nov 2024 00:00:00 GMTPythonai-agentslangchainautogenllmautomationaihttps://techyowls.io/blog/fastapi-tutorial-dependency-injection/https://techyowls.io/blog/fastapi-tutorial-dependency-injection/Master FastAPI dependency injection for clean, reusable code. Learn database sessions, authentication, pagination, and complex dependency chains.Tue, 19 Nov 2024 00:00:00 GMTPythonfastapipythondependency-injectionapitutorialaihttps://techyowls.io/blog/memento-design-pattern/https://techyowls.io/blog/memento-design-pattern/Master the Memento Pattern in Java. Learn how to capture and restore an object's internal state for undo/redo functionality.Tue, 19 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsmementoundostatehttps://techyowls.io/blog/numpy-python-tutorial/https://techyowls.io/blog/numpy-python-tutorial/Master NumPy for scientific computing. Learn arrays, mathematical operations, broadcasting, and data manipulation with practical examples.Tue, 19 Nov 2024 00:00:00 GMTPythonpythonnumpydata-sciencemachine-learningaiscientific-computinghttps://techyowls.io/blog/docker-compose-microservices/https://techyowls.io/blog/docker-compose-microservices/Master Docker Compose for local microservices development. Learn multi-container orchestration, networking, volumes, and production-ready configurations.Mon, 18 Nov 2024 00:00:00 GMTDevOpsdockerdocker-composemicroservicesdevopscontainersaihttps://techyowls.io/blog/fastapi-tutorial-response-models-status-codes/https://techyowls.io/blog/fastapi-tutorial-response-models-status-codes/Learn to control FastAPI responses with response models, status codes, and headers. Master data filtering, multiple response types, and proper HTTP semantics.Mon, 18 Nov 2024 00:00:00 GMTPythonfastapipythonapirest-apiresponsestutorialaihttps://techyowls.io/blog/nginx-reverse-proxy-docker/https://techyowls.io/blog/nginx-reverse-proxy-docker/Configure Nginx as a reverse proxy with Docker. Learn SSL setup, load balancing, caching, and production deployment with practical examples.Mon, 18 Nov 2024 00:00:00 GMTDevOpsnginxdockerdevopsreverse-proxysslaihttps://techyowls.io/blog/spring-security-fundamentals-architecture/https://techyowls.io/blog/spring-security-fundamentals-architecture/Master Spring Security internals. Learn FilterChain, SecurityContext, Authentication flow, and how Spring Security protects your application.Mon, 18 Nov 2024 00:00:00 GMTSpring Bootspring-securityspring-bootjavaauthenticationsecurityaihttps://techyowls.io/blog/stable-diffusion-image-generation/https://techyowls.io/blog/stable-diffusion-image-generation/Master Stable Diffusion for AI image generation. Learn prompting, ControlNet, LoRA fine-tuning, and build image generation applications.Mon, 18 Nov 2024 00:00:00 GMTPythonstable-diffusionaiimage-generationdiffusersmachine-learninghttps://techyowls.io/blog/fastapi-tutorial-request-bodies-pydantic/https://techyowls.io/blog/fastapi-tutorial-request-bodies-pydantic/Master Pydantic models in FastAPI. Learn request body validation, nested models, custom validators, and advanced data handling for robust APIs.Sun, 17 Nov 2024 00:00:00 GMTPythonfastapipythonpydanticvalidationapitutorialaihttps://techyowls.io/blog/mediator-design-pattern/https://techyowls.io/blog/mediator-design-pattern/Master the Mediator Pattern in Java. Learn how to reduce coupling by having objects communicate through a mediator instead of directly.Sun, 17 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsmediatorcouplingoophttps://techyowls.io/blog/mlops-machine-learning-operations/https://techyowls.io/blog/mlops-machine-learning-operations/Master MLOps for production ML systems. Learn model versioning, experiment tracking, CI/CD for ML, model serving, and monitoring best practices.Sun, 17 Nov 2024 00:00:00 GMTPythonmlopsmachine-learningdevopsmlflowkubeflowaihttps://techyowls.io/blog/spring-data-jpa-advanced/https://techyowls.io/blog/spring-data-jpa-advanced/Master Spring Data JPA with advanced queries, custom repositories, specifications, projections, and performance optimization techniques.Sun, 17 Nov 2024 00:00:00 GMTSpring Bootspring-bootspring-data-jpajavadatabasehibernateaihttps://techyowls.io/blog/computer-vision-opencv-python/https://techyowls.io/blog/computer-vision-opencv-python/Master computer vision with OpenCV Python. Learn image processing, object detection, face recognition, and build real-world vision applications.Sat, 16 Nov 2024 00:00:00 GMTPythonopencvcomputer-visionpythonimage-processingaimachine-learninghttps://techyowls.io/blog/docker-compose-spring-boot-complete-guide/https://techyowls.io/blog/docker-compose-spring-boot-complete-guide/Containerize Spring Boot apps with Docker Compose. Multi-service setup, health checks, volumes, and production deployment patterns.Sat, 16 Nov 2024 00:00:00 GMTDevOpsdockerspring-bootdevopscontainersaihttps://techyowls.io/blog/fastapi-tutorial-path-query-parameters/https://techyowls.io/blog/fastapi-tutorial-path-query-parameters/Master FastAPI path and query parameters. Learn parameter validation, type conversion, optional parameters, and advanced patterns for building flexible APIs.Sat, 16 Nov 2024 00:00:00 GMTPythonfastapipythonapirest-apiparameterstutorialaihttps://techyowls.io/blog/natural-language-processing-python/https://techyowls.io/blog/natural-language-processing-python/Learn NLP fundamentals with Python. Text preprocessing, sentiment analysis, named entity recognition, and building NLP applications with NLTK and spaCy.Sat, 16 Nov 2024 00:00:00 GMTPythonpythonnlpmachine-learningaidata-sciencetext-processinghttps://techyowls.io/blog/fastapi-tutorial-introduction-setup/https://techyowls.io/blog/fastapi-tutorial-introduction-setup/Start your FastAPI journey with this comprehensive guide. Learn installation, create your first API, understand async Python, and explore automatic documentation.Fri, 15 Nov 2024 00:00:00 GMTPythonfastapipythonapirest-apiweb-developmenttutorialaihttps://techyowls.io/blog/iterator-design-pattern/https://techyowls.io/blog/iterator-design-pattern/Master the Iterator Pattern in Java. Learn how to access elements of a collection sequentially without exposing its underlying representation.Fri, 15 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsiteratorcollectionsloopshttps://techyowls.io/blog/huggingface-transformers-tutorial/https://techyowls.io/blog/huggingface-transformers-tutorial/Master Hugging Face Transformers for NLP tasks. Learn text classification, named entity recognition, question answering, and fine-tuning models.Thu, 14 Nov 2024 00:00:00 GMTPythonpythonhuggingfacetransformersnlpaimachine-learninghttps://techyowls.io/blog/kafka-message-ordering-complete-guide/https://techyowls.io/blog/kafka-message-ordering-complete-guide/Master Kafka message ordering with single partitions, external sequencing, idempotent producers, and time window buffering. Production patterns included.Thu, 14 Nov 2024 00:00:00 GMTSystem Designkafkamessagingdistributed-systemsjavaevent-drivenaihttps://techyowls.io/blog/interpreter-design-pattern/https://techyowls.io/blog/interpreter-design-pattern/Master the Interpreter Pattern in Java. Learn how to define grammar and evaluate expressions for custom languages and DSLs.Wed, 13 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsinterpreterparsingdslhttps://techyowls.io/blog/postgresql-advanced-guide/https://techyowls.io/blog/postgresql-advanced-guide/Master PostgreSQL with advanced SQL queries, indexing strategies, performance optimization, JSON support, and production database management.Tue, 12 Nov 2024 00:00:00 GMTDevOpspostgresqldatabasesqlbackendperformanceaihttps://techyowls.io/blog/service-mesh-istio-guide/https://techyowls.io/blog/service-mesh-istio-guide/Master Istio service mesh for Kubernetes. Learn traffic management, security, observability, and build resilient microservices architectures.Tue, 12 Nov 2024 00:00:00 GMTDevOpsistioservice-meshkubernetesmicroservicesdevopsaihttps://techyowls.io/blog/command-design-pattern/https://techyowls.io/blog/command-design-pattern/Master the Command Pattern in Java. Learn how to encapsulate requests as objects to enable Undo/Redo, queuing, and macro commands.Mon, 11 Nov 2024 00:00:00 GMTJavaaijavadesign-patternscommandundo-redooophttps://techyowls.io/blog/sveltekit-fullstack-guide/https://techyowls.io/blog/sveltekit-fullstack-guide/Master SvelteKit for modern web development. Learn routing, server-side rendering, data loading, forms, and build performant full-stack applications.Sun, 10 Nov 2024 00:00:00 GMTJavaScriptsveltekitsveltefullstackjavascriptssraihttps://techyowls.io/blog/chain-of-responsibility-design-pattern/https://techyowls.io/blog/chain-of-responsibility-design-pattern/Master the Chain of Responsibility Pattern in Java. Learn how to pass requests along a chain of handlers until one of them handles it.Sat, 09 Nov 2024 00:00:00 GMTJavaaijavadesign-patternschain-of-responsibilitymiddlewareoophttps://techyowls.io/blog/github-actions-cicd-tutorial/https://techyowls.io/blog/github-actions-cicd-tutorial/Master GitHub Actions for CI/CD pipelines. Learn workflows, jobs, actions, secrets management, and deploy to any cloud platform automatically.Fri, 08 Nov 2024 00:00:00 GMTDevOpsgithub-actionscicddevopsautomationdeploymentaihttps://techyowls.io/blog/golang-rest-api-guide/https://techyowls.io/blog/golang-rest-api-guide/Build production-ready REST APIs with Go, Gin framework, PostgreSQL, and JWT authentication. Step-by-step tutorial with complete code examples.Fri, 08 Nov 2024 00:00:00 GMTGogolanggorest-apiginpostgresqltutorialbackendhttps://techyowls.io/blog/proxy-design-pattern/https://techyowls.io/blog/proxy-design-pattern/Master the Proxy Pattern in Java. Learn how to control access to objects, implement lazy loading, and add security layers.Thu, 07 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsproxysecuritylazy-loadinghttps://techyowls.io/blog/playwright-testing-guide/https://techyowls.io/blog/playwright-testing-guide/Master Playwright for browser automation and testing. Learn selectors, assertions, API testing, visual testing, and build reliable E2E test suites.Wed, 06 Nov 2024 00:00:00 GMTJavaScriptplaywrighttestinge2eautomationjavascriptaihttps://techyowls.io/blog/flyweight-design-pattern/https://techyowls.io/blog/flyweight-design-pattern/Master the Flyweight Pattern in Java. Learn how to support thousands of objects efficiently by sharing common state.Tue, 05 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsflyweightmemoryoptimizationhttps://techyowls.io/blog/facade-design-pattern/https://techyowls.io/blog/facade-design-pattern/Master the Facade Pattern in Java. Learn how to hide system complexity behind a simple interface and making your libraries easier to use.Sun, 03 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsfacadesimplicityapi-designhttps://techyowls.io/blog/decorator-design-pattern/https://techyowls.io/blog/decorator-design-pattern/Master the Decorator Pattern in Java. Learn how to add features to objects dynamically without inheritance explosions. The ultimate 'Wrapper' pattern.Fri, 01 Nov 2024 00:00:00 GMTJavaaijavadesign-patternsdecoratorcompositionoophttps://techyowls.io/blog/composite-design-pattern/https://techyowls.io/blog/composite-design-pattern/Master the Composite Pattern in Java. Learn how to treat individual objects and compositions uniformly using recursive tree structures.Wed, 30 Oct 2024 00:00:00 GMTJavaaijavadesign-patternscompositetreerecursionhttps://techyowls.io/blog/bridge-design-pattern/https://techyowls.io/blog/bridge-design-pattern/Master the Bridge Pattern in Java. Learn how to avoid class explosion by separating abstraction and implementation hierarchies.Mon, 28 Oct 2024 00:00:00 GMTJavaaijavadesign-patternsbridgecompositionoophttps://techyowls.io/blog/tailwind-css-complete-guide/https://techyowls.io/blog/tailwind-css-complete-guide/Master Tailwind CSS for modern web development. Learn utility classes, responsive design, custom configurations, and build beautiful UIs fast.Mon, 28 Oct 2024 00:00:00 GMTJavaScripttailwindcssweb-developmentfrontenddesignaihttps://techyowls.io/blog/adapter-design-pattern/https://techyowls.io/blog/adapter-design-pattern/Master the Adapter Design Pattern in Java. Learn how to integrate legacy code and 3rd-party libraries using the 'Travel Adapter' concept.Sat, 26 Oct 2024 00:00:00 GMTJavaaijavadesign-patternsadapterintegrationlegacy-codehttps://techyowls.io/blog/typescript-advanced-guide/https://techyowls.io/blog/typescript-advanced-guide/Master advanced TypeScript concepts. Learn generics, utility types, conditional types, mapped types, and professional patterns for type-safe code.Fri, 25 Oct 2024 00:00:00 GMTJavaScripttypescriptjavascriptprogrammingweb-developmenttypesaihttps://techyowls.io/blog/prototype-design-pattern/https://techyowls.io/blog/prototype-design-pattern/Master the Prototype Pattern in Java. Learn how to clone objects efficiently instead of creating expensive instances from scratch.Thu, 24 Oct 2024 00:00:00 GMTJavaaijavadesign-patternsprototypecloningoophttps://techyowls.io/blog/builder-design-pattern/https://techyowls.io/blog/builder-design-pattern/Master the Builder Pattern in Java. Learn how to construct complex objects step-by-step, avoid telescoping constructors, and write readable code.Tue, 22 Oct 2024 00:00:00 GMTJavaaijavadesign-patternsbuilderclean-codeoophttps://techyowls.io/blog/abstract-factory-design-pattern/https://techyowls.io/blog/abstract-factory-design-pattern/Master the Abstract Factory Pattern in Java. Learn how to create families of related objects without specifying their concrete classes.Sun, 20 Oct 2024 00:00:00 GMTJavaaijavadesign-patternsabstract-factorycreationfactoryhttps://techyowls.io/blog/factory-method-design-pattern/https://techyowls.io/blog/factory-method-design-pattern/Master the Factory Method Pattern in Java. Learn how to loosen coupling in your code by letting subclasses decide which objects to instantiate.Fri, 18 Oct 2024 00:00:00 GMTJavaaijavadesign-patternsfactoryclean-codeoophttps://techyowls.io/blog/fetch-data-with-react-hooks/https://techyowls.io/blog/fetch-data-with-react-hooks/Create a custom React hook for data fetching with loading states. Learn how to build reusable hooks that simplify API calls in functional components.Sat, 15 Feb 2020 00:00:00 GMTJavaScriptreactjshooksjavascriptfetchcustom-hookshttps://techyowls.io/blog/dark-mode-with-react-hooks/https://techyowls.io/blog/dark-mode-with-react-hooks/Learn how to add dark mode functionality to your React application using useState and useEffect hooks with localStorage persistence.Fri, 14 Feb 2020 00:00:00 GMTJavaScriptjavascriptreactjshookscsscreate-react-apphttps://techyowls.io/blog/javascript-map-filter/https://techyowls.io/blog/javascript-map-filter/Master JavaScript's ES6 array helper methods map() and filter() with practical examples. Learn how to transform and filter arrays like a pro.Mon, 20 Jan 2020 00:00:00 GMTJavaScriptjavascriptarrayes6functional-programminghttps://techyowls.io/blog/javascript-primer/https://techyowls.io/blog/javascript-primer/Master core JavaScript concepts including higher-order functions, arrow functions, closures, and the spread operator with practical examples.Fri, 17 Jan 2020 00:00:00 GMTJavaScriptjavascriptes6fundamentalshttps://techyowls.io/blog/rest-api-with-flask/https://techyowls.io/blog/rest-api-with-flask/Complete guide to building REST APIs using Flask, SQLAlchemy for ORM, and Marshmallow for serialization. Includes SQLite and MySQL setup.Sun, 12 Jan 2020 00:00:00 GMTPythonpythonflasksqlalchemyrest-apimarshmallowdockerhttps://techyowls.io/blog/day-to-day-docker/https://techyowls.io/blog/day-to-day-docker/Essential Docker commands for everyday use. Quick reference for container management, cleanup, and common operations.Fri, 10 Jan 2020 00:00:00 GMTDevOpsdockerdocker-composedevopscontainershttps://techyowls.io/blog/introduction-to-spring-data-redis/https://techyowls.io/blog/introduction-to-spring-data-redis/Learn how to integrate Redis with Spring Boot using Spring Data Redis. Complete guide with Docker setup and practical examples.Fri, 10 Jan 2020 00:00:00 GMTSpring Bootspring-bootjavaredisdockerspring-datahttps://techyowls.io/blog/java-final-class/https://techyowls.io/blog/java-final-class/Learn when and why to use final classes in Java. Understand the design principle of prohibiting inheritance for better code safety.Mon, 06 Jan 2020 00:00:00 GMTJavajavacore-javainheritanceoophttps://techyowls.io/blog/list-comprehensions-python/https://techyowls.io/blog/list-comprehensions-python/Master Python list comprehensions to write more readable and efficient code. Learn syntax, examples, and when to use them over traditional loops.Mon, 06 Jan 2020 00:00:00 GMTPythonpythonlist-comprehensionfunctional-programminghttps://techyowls.io/blog/good-friend-lombok/https://techyowls.io/blog/good-friend-lombok/Complete guide to Project Lombok for Java. Learn how to eliminate boilerplate code with annotations like @Data, @Builder, and @RequiredArgsConstructor.Sun, 22 Dec 2019 00:00:00 GMTJavajavalombokspring-bootproductivityhttps://techyowls.io/blog/mysql-docker-compose/https://techyowls.io/blog/mysql-docker-compose/Learn how to set up MySQL using Docker Compose for local development. Includes configuration, volumes, networking, and common commands.Fri, 20 Dec 2019 00:00:00 GMTDevOpsdockerdocker-composemysqldevopsdatabasehttps://techyowls.io/blog/singleton-design-pattern-part-2/https://techyowls.io/blog/singleton-design-pattern-part-2/Advanced singleton implementations including Double-Checked Locking with volatile and the Bill Pugh pattern using static inner classes.Thu, 19 Dec 2019 00:00:00 GMTJavajavadesign-patternssingletonconcurrencyhttps://techyowls.io/blog/singleton-design-pattern-part-1/https://techyowls.io/blog/singleton-design-pattern-part-1/Deep dive into the Singleton design pattern in Java. Learn different implementation approaches including eager initialization and lazy loading.Wed, 18 Dec 2019 00:00:00 GMTJavajavadesign-patternssingletonoop